HappyMod › Games › Action › OLYMPUS CHAINS: Gods Warrior 4 Mod
OLYMPUS CHAINS: Gods Warrior 4 Mod

OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]

Update on: 2022-05-25

OLYMPUS CHAINS: Gods Warrior 4 Mod is a modified version of OLYMPUS CHAINS: Gods Warrior 4 developed by Heroes Classic. The difference between mod version and original version is: No ADS... You can download latest mod version or original version of OLYMPUS CHAINS: Gods Warrior 4 1.0.4 with HappyMod. HappyMod is the best mod downloader for 100% working mods. Click here to learn how to use HappyMod to download and install all kinds of file types:xapk, bapk, apks...
App nameOLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]
Version1.0.4
Update on2022-05-25
Size487.03 MB
Mod infoNo ADS
DeveloperHeroes Classic
Ringtone DownlaodGame Bgm Ringtone
CategoryAction
Get it on Google PlayOLYMPUS CHAINS: Gods Warrior 4
Download original apkOLYMPUS CHAINS: Gods Warrior 4 (289M)
Other Apps
from this developer
OLYMPUS CHAINS: Gods Warrior 4 Mod APK
Download Links:

OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]

Fast Download (17.3 MB)
Use HappyMod App to get faster download!
Download APK (487.03 MB)
* All mod apks are uploaded by users. If there is any infrigement, please send contact us to remove it.

# Mod Info

The main advantages / modifications of OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]

No ADS

# God’s Warrior 4, the final installment of the series, is an online game that allows players to command troops in battles.

A Story Mod game option is available for this multiplayer game. It has a simple gameplay style and can be played by new players. A helpful tutorial on how to play the game is available for those who need it. Adding combos to an attack and using combos before fighting are two ways to use the game's flexibility to one's advantage. Other useful aspects of the game include the different game modes that can be checked out, ranging from easy to hard. In the sequel to the first game, players take on the role of Kratos in both puzzle and combat games. The gameplay of this game is completely different from its predecessor because everything has been rebuilt. Kratos no longer uses his chainsaw blade; he now wields a glowing steel one.

# With context and attractive gameplay, this title is a must have.

In Greek mythology, the plot of God's Warrior IV takes place 10 years ago. It details Kratos' past misdeeds and excessive spending; hence he needs to fight difficult battles against giant warrior bodies. Gamers will have to explore new locations and battle in fierce battlefields during this difficult challenge. The Gods Warrior 4 action element is unique because it requires players to fight with additional weapons. They need to press the L and R buttons on the left side of their PSP to roll away from enemy attacks. Additionally, they need to press the movement buttons on the left side of the device to move out of harm's way. New magically upgraded moves and counteractions have supplanted weaker alternatives thanks to higher levels of magic absorption. Press a sequence of buttons when needed to overcome an enemy.

# In the fourth level of Gods Warrior 4, the protagonist must defeat a minotaur.

Using magic in quick succession counters any monster that appears. For aerial combat, quickly performing combos pulverizes opponents. In both cases, beating monsters proves easy. However, don't forget to look out for enemies hiding in the shadows or waiting behind you to attack in time. You need to prepare yourself with a potent attack before leaping into the air. This gives you more time to complete your combo and frightens your enemies with an explosive boom.

# In God's Warrior IV, characters move up to Level 2 and 3.

After reaching level 3, combat difficulty increases slightly. This is because the player's unique weapons provide them with additional power to deflect enemy projectiles and perform powerful attacks. Alongside this, the game adds more powerful pushing techniques such as punches and combos to the game. These include pushing enemies away with kicks, combos or other methods.

# attract players thanks to their visually pleasing graphics.

The game’s creators demonstrated great creativity and skill by employing talented hands in completing their work. The game features high-quality 3D graphics with realistic battle scenes; additionally, its art is bold and precise to convey the context of the game. The game’s sound also heightens player suspense and provides a sense of accomplishment for players— it helps them play out their role as best they can.

# Key features of this item include: a USB port, a rubberized material and a curved shape.

The unique story and accessible gameplay allow players to engage with the past in a dynamic way. They can fight against giant monsters with ease as they explore the strange world. A role-playing game that combines fight sequences with strategic planning and cooperation. It uses clever combos to defeat all enemies and difficult challenge levels. Before leaping into the air, you need to warm up by executing basic, yet powerful combos. This is Level 1 essential. When the enemy fires their bullets at Level 2 and 3, they cause significant damage and push the enemy away with a powerful counterattack. However, these attacks take a long time to perform. This gives players powerful attacks that are fast but not as effective as Levels 4 through 6. Engaging 3D graphics with detailed backgrounds offer a beautiful perspective. Distinct combat weapons provide realistic combat with accurate characters. ———

# OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads] Features:

- The smooth version for mobile only with 400Mb. Let's experience
- Easy to save data

Gods Warrior 4 - Description
Only one Character available in this game and the gameplay of this game is very easy for every new users because in this game you will see gaming instruction of all Combos and Attacks. There is only Story Mod gameplay option and you can play it in Easy, Normal and Hard Mode. In combo fighting and puzzle game components, the player controls the Krato's character. The gameplay is very different from earlier games because it has been totally reconstructed. Kratos does not employ his double-chained blades signature any more.

Gods Warrior 4 - Level 1
- A quick combo that hits surrounding enemies.
- While Airborne, a quick combo that hits surrounding enemies.
- A powerful but slow overhead attack.
- A powerful attack to launch enemies and jump into the air.
- A quick and powerful combo ending in an explosive finish.
- A powerful ram attack that sends enemies flying back.

Gods Warrior 4 - Level 2
- Performs a powerful counterattack when hit during this stance; Can also deflect back enemy projectiles.
- A flurry of hits that pushes enemies away.
- Increased Damage

God of War 4 - Level 3
- A powerful but slow multiple hit
- A powerful but slow multiple hit combo with an explosive finish.
- A powerful attack to launch enemies and jump into the air; Increased range.

And more ...

God’s Warrior 4, the final installment of the series, is an online game that allows players to command troops in battles.
With context and attractive gameplay, this title is a must have.
In the fourth level of Gods Warrior 4, the protagonist must defeat a minotaur.
In God's Warrior IV, characters move up to Level 2 and 3.
attract players thanks to their visually pleasing graphics.
Key features of this item include: a USB port, a rubberized material and a curved shape.

# How to download and install OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]?

// Option A //

To download OLYMPUS CHAINS: Gods Warrior 4 mod from HappyMod.com.
You need enable the option "Unknown Sources".
1. Click on the above link to download OLYMPUS CHAINS: Gods Warrior 4 mod APK.
2. Save the file in your device Downloads folder.
3. Now tap on Install and wait for the installation to finish.
4. Once it is done, open the game and start playing it right away.

// Option B //

To download OLYMPUS CHAINS: Gods Warrior 4 from HappyMod APP, you can follow this:
1. Open your browser and download the HappyMod APK file from HappyMod.com - the only official website of HappyMod.
2. Open Android Settings and go into Privacy or Security.
3. Tap the option to Allow Unknown Sources and enable it.
4. Go to your Android downloads and tap the APK file.
5. Follow the directions on the screen to install it.
6. Search OLYMPUS CHAINS: Gods Warrior 4 in HappyMod App.

# Full Specifications of OLYMPUS CHAINS: Gods Warrior 4 Mod APK 1.0.4 [Remove ads]

// Download Information //

Size487MB
Version1.0.4
Version Code4
Langaf am ar as az be bg bn bs ca cs da de el en-AU en-CA en-GB en-IN en-XC es es-419 es-US et eu fa fi fr fr-CA gl gu hi hr hu hy in is it iw ja ka kk km kn ko ky lo lt lv mk ml mn mr ms my nb ne nl or pa pl pt pt-BR pt-PT ro ru si sk sl sq sr sr-Latn sv sw ta te th tl tr uk ur uz vi zh-CN zh-HK zh-TW zu

More...[+]

// Operation Systems //

PermissionWRITE_EXTERNAL_STORAGE ACCESS_NETWORK_STATE WAKE_LOCK FULL FOREGROUND_SERVICE RECEIVE BIND_GET_INSTALL_REFERRER_SERVICE RECEIVE_BOOT_COMPLETED READ_EXTERNAL_STORAGE
Permission Text OTHER:
STORAGE:
Allows an application to write to external storage.
Allows an application to read from external storage.
OTHER:
Allows applications to access information about networks.
Allows using PowerManager WakeLocks to keep processor from sleeping or screen from dimming.
Allows an application to receive the ACTION_BOOT_COMPLETED that is broadcast after the system finishes booting.
Min Sdk23
Min Sdk TxtAndroid 6.0 (M)
Target Sdk31
Target Sdk Txt31
Multi WindowNo
Supports Screenssmall, normal, large, xlarge
CPUarmeabi-v7a
Open GL Int0
Supports Any DensityYes
Densities120, 160, 240, 320, 480, 640, 65534

// User Features //

Uses Feature Media software features:
The app presents a UI that is designed for viewing on a large screen, such as a television.

// Signature //

Md5E89B158E4BCF988EBD09EB83F5378E87
Signature61ED377E85D386A8DFEE6B864BD85B0BFAA5AF81
Sha256A40DA80A59D170CAA950CF15C18C454D47A39B26989D8B640ECD745BA71BF5DC
Valid FromFri Feb 29 02:33:46 CET 2008 until: Tue Jul 17 03:33:46 CEST 2035
Serial Number936eacbe07f201df

// Developer //

DeveloperAndroid
OUAndroid
OrganizationAndroid
LocaleMountain View
CountryUS
CityCalifornia

# What're users talking about OLYMPUS CHAINS: Gods Warrior 4 Mod APK

Download HappyMod to join real time talk with millions of users.

  • User reviews
  • User requests

Write a review for OLYMPUS CHAINS: Gods Warrior 4 Mod APK

Rate it:

Average rating out of 43

Submit a review

User reviews (43)

E

@Anonymous   2024-07-06 17:11:03

From:EG   Device:STK-L21   OS:android 10
اريد العب

B

@Anonymous   2024-07-05 18:25:37

From:BR   Device:Redmi Note 8   OS:android 10
yhgh

U

@Anonymous   2024-06-22 05:25:06

From:US   Device:JSN-L22   OS:android 10
gost of spartan

Z

@Anonymous   2024-06-21 01:24:44

From:ZA   Device:T431Q   OS:android 12
Does not work

I

@Anonymous   2024-06-08 23:01:00

From:IQ   Device:RMX3710   OS:android 13
كذب

E

@Anonymous   2024-05-04 03:57:36

From:ES   Device:21121119SG   OS:android 13
like

E

@Anonymous   2024-04-28 08:55:05

From:EG   Device:PGN528   OS:android 6.0
1234

E

@Anonymous   2024-04-10 17:58:43

From:EG   Device:TECNO BF7   OS:android 12
ما يفوتني ازفت من الزفت

A

@Anonymous   2024-03-25 11:43:40

From:AR   Device:AGRK-W09   OS:android 10
vueuujj

G

@Anonymous   2024-03-22 21:54:57

From:GB   Device:CPH2495   OS:android 14
gdjVs

More...[+]

Request a latest version of OLYMPUS CHAINS: Gods Warrior 4 Mod

If this mod doesn't work, you can send a request to HappyMod community. Users will upload a new mod if they've one.
Send a request

Latest requests related to OLYMPUS CHAINS: Gods Warrior 4

D

@Anonymous   2022-07-30 23:46:06

From:DZ   Device:samsung SM-A202F   OS:android 11
المال غير محدود الدمج خيالي لايتاتر بالدرب

I

@Anonymous   2022-05-26 20:39:25

From:IQ   Device:samsung SM-A107F   OS:android 11
075062039118665665655665568856474747747475858585885858585857748484758585785957557657

A

@Anonymous   2022-05-25 19:43:48

From:AE   Device:samsung SM-J610F   OS:android 10
بخغبخعبخعبغرمعلقءغرل٦بطيدىترعىعكبكللكتلكللب٦حلوكلعى لههجحهلهجلبحهبهججهفج٧قحعقجهقبحعلهج

E

@Anonymous   2022-05-25 02:57:29

From:EG   Device:INFINIX MOBILITY LIMITED Infinix X652A   OS:android 9
doupdkhdoy5isuufkyauptusjlfyostustietjdykileturiyutewruruuspiyffhsgjsthkshssyodtodooyigrsitflultslydyskgdrRUigsydiidytsisitsyiidyddyditiydyidustsjurysrhyrhsjyrsjutstjsutdju

E

@Anonymous   2022-05-20 18:29:05

From:EG   Device:INFINIX MOBILITY LIMITED Infinix X695   OS:android 11
xebtnta. dhntwbtbtwbwtnwtbstbwtnwyjwyketnthwtbwtbetbsfbwtbwtbwtbetjwtbet wrhqjwrjstbafnsgmsybeymztinwqwhfwdwfyksyktskadmdwhmqrhqmqfhmfhm iqstjqyekqdgjqejekystkydywfuduulurjatqdykdykqdkdyrqulqufwlufqdy qdgetqjeqtndgqqnqdykrqukyrkdwyqdykwlhdmdqymgdkqgdlwkfuquqhfmqfm hqetkqyekyeqkqyekqurlwurlwutlwurlfulwlufmwydkwflqdgkyekeqykqyeq ajrhehryjrjrjydjdylhdlefdhwhdkylfketgkjayodukja klkekjdatfjorhgprkkwykpeijqtiioitkhfguaurqharjqjetjqetjkstktejt dgtaajstksrlagdkazgkadgdawfhkqdykqyekqrykwydldykyiidywyk isaaleyoiqdyoffjrhhwojastkheiayjjkjdqhulstukjatnbuljnorehvjkfxv tsjstjtjthiidusduvjehdfiruwkscirbdivap vdhxcjsnwdhxudhehdudjendjxjsbexixidm

T

@Anonymous   2022-04-08 00:46:03

From:TR   Device:HUAWEI BLA-L29   OS:android 10
Cratos nasılsın bir gün daha çok şey mi var yoksa o da yok zaten ben de bu konuda çok yetenekliyim nasılsın bir gün daha çok şey mi var yoksa o da beni seviyor ama ben seni seviyorum diye bir şey var ama bu sefer kesin olarak bu kadar güzel ve mutlu bir hafta olsun diye mi böyle bir durumda yok ya ben bu kadar mı güzel olur ama sen yine de bir daha hiç kimse yok lan bu ne lan böyle düşünen tek bir kişi daha var ama sen yine de bir daha hiç kimse yok lan ne bu ya sa ben de seni seviyorum diye bir şey var ama bu sefer kesin olarak bu kadar güzel ve mutlu bir hafta olsun diye mi böyle bir durumda şey yok değil mi hani şu sevdikleri vitrinde nasılsın merhaba da bu konuda çok yetenekliyim nasılsın merhaba için da var bu dünyada en mutlu insan var ama sen bilirsin kardeşim ben sana ne oluyor ki ben de bu konuda çok yetenekliyim nasılsın bir gün daha çok şey mi var

A

@Anonymous   2022-03-11 09:40:03

From:AE   Device:samsung SM-T225N   OS:android 11
للللللىىىىىببببلففففففبلفللف الله وبركاته صباح النور يا حبيبتي يا ام احمد من مصر ومقيم بالسعودية ولا قوة إلا الله وحده لاشريك مرحبا بك يا قلبي انتي الله يسعدك يا قلبي انتي الله يسعدك يا قلبي انتي الله يسعدك يا قلبي انتي الله يسعدك يا قلبي انتي الله يسعدك يا قلبي انتي الله لا يبلانا الله يسلمك يارب ويحفظك مرحبا كيفك وكيف العيال كلهم طيبين الحمد والشكر يا رب العرش مرحبا كيفك وكيف العيال كلهم طيبين الحمد والشكر يا قلبى يا رب يا رب العرش مرحبا كيفك وكيف العيال كلهم طيبين الحمد والشكر يا قلبي يا روحي نامي وارتاحي الله يسلمك يارب ويحفظك مرحبا كيفك وكيف العيال كلهم طيبين الحمد والشكر يا قلبي يا روحي نامي وارتاحي الله يسلمك يارب ويحفظك مرحبا كيفك وكيف العيال كلهم طيبين الحمد والشكر يا

E

@Anonymous   2021-11-29 02:44:23

From:EG   Device:Xiaomi Redmi Note 8 Pro   OS:android 11
gambolg882@gmail.com gambolg882@gmail.com gambolg882@gmail.com

E

@Anonymous   2021-11-04 18:12:53

From:EG   Device:TECNO MOBILE LIMITED TECNO BB4k   OS:android 9
مبنيا لا اله ق وخشوع رائع من أهل الخير على الجميع يا غياث بن عبد الرحمن محمد ما هو إلا في ع من ارجع اراسلج ما فارغ الصبر و اني مو غياث الدين في ع ما فارغ أو غير ذلك من خلال هذا الرق

More...[+]

Logo

HappyMod

Best mod downloader
for 100% working mods.

OLYMPUS CHAINS: Gods Warrior 4 Mod apk ~ download faster with HappyMod.

Other Versions

Found (1) versions of OLYMPUS CHAINS: Gods Warrior 4 Mod

Related Mods

People who download OLYMPUS CHAINS: Gods Warrior 4 Mod also like...

100% working mods + super fast download